Structure of PDB 1tpy Chain A

Receptor sequence

>1tpyA (length=285) Species: 1773 (Mycobacterium tuberculosis)

NDLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFEREDMTLEEAQIAK
IDLALGKLGLQPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQAAH
VQKSFDEMDTPRDRRVLLAGWEQFNEPVDRIVSIGAFEHFGHDRHADFFA
RAHKILPPDGVLLLHTITGLTRQQMVDHGLPLTLWLARFLKFIATEIFPG
GQPPTIEMVEEQSAKTGFTLTRRQSLQPHYARTLDLWAEALQEHKSEAIA
IQSEEVYERYMKYLTGCAKLFRVGYIDVNQFTLAK

3D structure

• PDB: 1tpy Structure of the cyclopropane synthase MmaA2 from Mycobacterium tuberculosis
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.79: cyclopropane-fatty-acyl-phospholipid synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO3	A	S34 C35 G137 E140 H167 T168 I169 Y232	S32 C33 G135 E138 H165 T166 I167 Y230
BS02	SAH	A	V12 Y16 T32 Y33 S34 G72 G74 T94 L95 Q99 G122 W123 E124 I136 A138 H141 F142	V10 Y14 T30 Y31 S32 G70 G72 T92 L93 Q97 G120 W121 E122 I134 A136 H139 F140
BS03	16A	A	Y16 Y33 G137 I169 F200 G203 P205 Y232 C269	Y14 Y31 G135 I167 F198 G201 P203 Y230 C267

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008825 cyclopropane-fatty-acyl-phospholipid synthase activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0008610 lipid biosynthetic process
• GO:0032259 methylation
• GO:0071768 mycolic acid biosynthetic process

Cellular Component

• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:1tpy, PDBe:1tpy, PDBj:1tpy
• PDBsum: 1tpy
• UniProt: Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 (Gene Name=mmaA2)