Structure of PDB 1toq Chain A

Receptor sequence
>1toqA (length=133) Species: 291940 (Artocarpus hirsutus) [Search protein sequence]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHSSFISG
FTPVKISLDFPSEYITEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWMDYFSMYLSL
3D structure
PDB1toq Two orthorhombic crystal structures of a galactose-specific lectin from Artocarpus hirsuta in complex with methyl-alpha-D-galactose.
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T72 V79 F104 D125 Y126 F127 S128 M129 Y130 L131 T72 V79 F104 D125 Y126 F127 S128 M129 Y130 L131
BS02 peptide A N105 P107 E109 N110 L133 N105 P107 E109 N110 L133
BS03 peptide A T10 P61 Y64 L133 T10 P61 Y64 L133
BS04 AMG A G1 Y78 G121 Y122 W123 D125 G1 Y78 G121 Y122 W123 D125
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1toq, PDBe:1toq, PDBj:1toq
PDBsum1toq
PubMed15272163
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]