Structure of PDB 1tlm Chain A

Receptor sequence

>1tlmA (length=123) Species: 9606 (Homo sapiens)

TGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGE
LHGLTTEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRR
YTIAALLSPYSYSTTAVVTNPKE

3D structure

• PDB: 1tlm Structural aspects of inotropic bipyridine binding. Crystal structure determination to 1.9 A of the human serum transthyretin-milrinone complex.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MIL	A	L17 L110 S117 T118	L13 L106 S113 T114

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1tlm, PDBe:1tlm, PDBj:1tlm
• PDBsum: 1tlm
• PubMed: 8454595
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)