Structure of PDB 1tl4 Chain A |
>1tl4A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] |
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDT LLATLKKTGKTVSYLGLE |
|
PDB | 1tl4 Solution Structure of the Apo and Copper(I)-Loaded Human Metallochaperone HAH1. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
C12 C15 |
C12 C15 |
|
|
|
|