Structure of PDB 1tid Chain A

Receptor sequence
>1tidA (length=136) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence]
MRNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIKTVVSEAVTN
AIIHGYNNDPNGIVSISVIIEDGVVHLTVRDEGVGIPDIEEARQPLFTTK
PELERSGMGFTIMENFMDEVIVESEVNKGTTVYLKK
3D structure
PDB1tid Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
ChainA
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E46 N50 R105
Catalytic site (residue number reindexed from 1) E46 N50 R105
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ATP A N50 H54 D81 V84 G85 I86 F97 T98 T99 R105 S106 G107 M108 G109 F110 T130 N50 H54 D81 V84 G85 I86 F97 T98 T99 R105 S106 G107 M108 G109 F110 T130
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016989 sigma factor antagonist activity
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0010468 regulation of gene expression
GO:0016310 phosphorylation
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0030436 asexual sporulation
GO:0042174 negative regulation of sporulation resulting in formation of a cellular spore
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1tid, PDBe:1tid, PDBj:1tid
PDBsum1tid
PubMed15236958
UniProtO32727|SP2AB_GEOSE Anti-sigma F factor (Gene Name=spoIIAB)

[Back to BioLiP]