Structure of PDB 1thn Chain A

Receptor sequence

>1thnA (length=136) Species: 1422 (Geobacillus stearothermophilus)

RNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIKTVVSEAVTNA
IIHGYNNDPNGIVSISVIIEDGVVHLTVRDEGVGIPDIEEARQPLFTTKP
ELERSGMGFTIMENFMDEVIVESEVNKGTTVYLKKH

3D structure

• PDB: 1thn Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E46 N50 R105
• Catalytic site (residue number reindexed from 1): E45 N49 R104
• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	N50 H54 G55 F97 T98 T99 R105 G107 G109 F110	N49 H53 G54 F96 T97 T98 R104 G106 G108 F109

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016989 sigma factor antagonist activity
• GO:0044024 histone H2AS1 kinase activity
• GO:0106310 protein serine kinase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006468 protein phosphorylation
• GO:0010468 regulation of gene expression
• GO:0016310 phosphorylation
• GO:0030435 sporulation resulting in formation of a cellular spore
• GO:0030436 asexual sporulation
• GO:0042174 negative regulation of sporulation resulting in formation of a cellular spore
• GO:0045892 negative regulation of DNA-templated transcription

External links

• PDB: RCSB:1thn, PDBe:1thn, PDBj:1thn
• PDBsum: 1thn
• PubMed: 15236958
• UniProt: O32727|SP2AB_GEOSE Anti-sigma F factor (Gene Name=spoIIAB)