Structure of PDB 1tf3 Chain A

Receptor sequence

>1tf3A (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence]

MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHH
LTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK

3D structure

PDB

1tf3 Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.

Chain

Resolution

N/A

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	W28 K29 A32 S35 K36 G53 F54 T55 H59 R62 H63 T66 K71 F84 T85 N89 K92 H93 R96 F97	W19 K20 A23 S26 K27 G44 F45 T46 H50 R53 H54 T57 K62 F75 T76 N80 K83 H84 R87 F88
BS02	dna	A	M1 K11 Y13 N25 K26 N27 W28 H58 K87 K91	M1 K2 Y4 N16 K17 N18 W19 H49 K78 K82
BS03	ZN	A	C15 C20 H33 H37	C6 C11 H24 H28
BS04	ZN	A	C50 H63 H67	C41 H54 H58
BS05	ZN	A	H93 H98	H84 H89

External links

PDB	RCSB:1tf3, PDBe:1tf3, PDBj:1tf3
PDBsum	1tf3
PubMed	9253405
UniProt	P03001\|TF3A_XENLA Transcription factor IIIA (Gene Name=gtf3a)