Structure of PDB 1teg Chain A

Receptor sequence
>1tegA (length=99) Species: 3562 (Spinacia oleracea) [Search protein sequence]
VEVLLGGGDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGV
DAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
3D structure
PDB1teg Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 A and 1.96 A resolution, respectively.
ChainA
Resolution1.96 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H37 C84 H87 M92
Catalytic site (residue number reindexed from 1) H37 C84 H87 M92
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU A H37 C84 H87 H37 C84 H87
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0009055 electron transfer activity

View graph for
Molecular Function
External links
PDB RCSB:1teg, PDBe:1teg, PDBj:1teg
PDBsum1teg
PubMed
UniProtP00289|PLAS_SPIOL Plastocyanin, chloroplastic (Gene Name=PETE)

[Back to BioLiP]