Structure of PDB 1t9i Chain A

Receptor sequence
>1t9iA (length=153) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
NTKYNKEFLLYLAGFVDGNGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS
3D structure
PDB1t9i Metal-Dependent DNA Cleavage Mechanism of the I-CreI LAGLIDADG Homing Endonuclease.
ChainA
Resolution1.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G19 N20
Catalytic site (residue number reindexed from 1) G18 N19
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A N20 S22 Q26 N30 Q44 T46 Q47 K48 R51 R70 V73 N136 D137 S138 R141 K142 N19 S21 Q25 N29 Q43 T45 Q46 K47 R50 R69 V72 N135 D136 S137 R140 K141 PDBbind-CN: Kd=1.8nM
BS02 dna A S32 Y33 K34 Q38 R68 R70 E80 I81 D137 K139 S31 Y32 K33 Q37 R67 R69 E79 I80 D136 K138 PDBbind-CN: Kd=1.8nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t9i, PDBe:1t9i, PDBj:1t9i
PDBsum1t9i
PubMed15518550
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]