Structure of PDB 1t6w Chain A |
>1t6wA (length=99) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
RDSGTVWGALGHGIDLDIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFL KSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILE |
|
PDB | 1t6w Design of a calcium-binding protein with desired structure in a cell adhesion molecule. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D15 D17 N60 D62 |
D15 D17 N60 D62 |
|
|
|