Structure of PDB 1t6o Chain A

Receptor sequence
>1t6oA (length=49) Species: 11234 (Measles morbillivirus) [Search protein sequence]
GASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIM
3D structure
PDB1t6o Structural basis for the attachment of a paramyxoviral polymerase to its template.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y480 L481 D487 I488 K489 D493 F497 M500 I504 Y23 L24 D30 I31 K32 D36 F40 M43 I47
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0019079 viral genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1t6o, PDBe:1t6o, PDBj:1t6o
PDBsum1t6o
PubMed15159535
UniProtQ77M42|PHOSP_MEASM Phosphoprotein (Gene Name=P)

[Back to BioLiP]