Structure of PDB 1t2t Chain A

Receptor sequence

>1t2tA (length=96) Species: 10665 (Tequatrovirus T4) [Search protein sequence]

KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKK
PSNIKKISCDGVIFDCAADAARHFKISSGLVTYRVKSDKWNWFYIN

3D structure

PDB

1t2t Intron-encoded homing endonuclease I-TevI also functions as a transcriptional autorepressor.

Chain

Resolution

2.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R170 G172 N175 F177 N179 H180 K181 H182 I190 S191 M194 K195 K197 K198 P199 N201 I202 K203 C214 A215 A216 R220 T230 Y242	R22 G24 N27 F29 N31 H32 K33 H34 I42 S43 M46 K47 K49 K50 P51 N53 I54 K55 C66 A67 A68 R72 T82 Y94	PDBbind-CN: Kd=5.3nM
BS02	dna	A	Q158 A161 Y162 T163 C164 S165 R168 S176 F177 H182 T186 I190 K193 M194 K197 S200 N201 S225 L228 Y231 K237	Q10 A13 Y14 T15 C16 S17 R20 S28 F29 H34 T38 I42 K45 M46 K49 S52 N53 S77 L80 Y83 K89	PDBbind-CN: Kd=5.3nM
BS03	ZN	A	C153 C164 C167	C5 C16 C19

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity

External links

PDB	RCSB:1t2t, PDBe:1t2t, PDBj:1t2t
PDBsum	1t2t
PubMed	15361856
UniProt	P13299\|TEV1_BPT4 Intron-associated endonuclease 1 (Gene Name=ITEVIR)