Structure of PDB 1sx5 Chain A

Receptor sequence

>1sx5A (length=244) Species: 562 (Escherichia coli)

SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTAVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENE
KIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTY
NINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVE
GKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK

3D structure

• PDB: 1sx5 DNA cleavage by EcoRV endonuclease: Two metal ions in three metal ion binding sites
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	N70 G109 T111 S112 K119	N69 G108 T110 S111 K118
BS02	dna	A	T37 E45 D74 K92 T93 T94 Y95 T106 S183 T186 N188	T36 E44 D73 K91 T92 T93 Y94 T105 S182 T185 N187
BS03	dna	A	S183 G184 N185 T222 S223	S182 G183 N184 T221 S222
BS04	dna	A	Q69 N70 H71	Q68 N69 H70
BS05	MN	A	E45 D74	E44 D73
BS06	MN	A	E45 D74 I91	E44 D73 I90
BS07	MN	A	H195 D198	H194 D197

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1sx5, PDBe:1sx5, PDBj:1sx5
• PDBsum: 1sx5
• PubMed: 15170321
• UniProt: P04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)