Structure of PDB 1stx Chain A

Receptor sequence

>1stxA (length=244) Species: 562 (Escherichia coli) [Search protein sequence]

SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTAVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENE
KIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTY
NINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVE
GKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK

3D structure

PDB

1stx DNA cleavage by EcoRV endonuclease: two metal ions in three metal ion binding sites

Chain

Resolution

2.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	N70 G109 T111 S112 K119 N120 T186	N69 G108 T110 S111 K118 N119 T185
BS02	dna	A	T37 K92 T94 Y95 T106 S183 N188	T36 K91 T93 Y94 T105 S182 N187
BS03	dna	A	S183 G184 N185 T222 S223 R226	S182 G183 N184 T221 S222 R225
BS04	dna	A	Q68 Q69 N70 H71	Q67 Q68 N69 H70
BS05	MN	A	E45 D74 D90 I91	E44 D73 D89 I90
BS06	MN	A	E45 D74	E44 D73
BS07	MN	A	Q68 H71	Q67 H70
BS08	MN	A	K102 I103 H193	K101 I102 H192

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1stx, PDBe:1stx, PDBj:1stx
PDBsum	1stx
PubMed	15170321
UniProt	P04390\|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]