Structure of PDB 1srr Chain A

Receptor sequence

>1srrA (length=119) Species: 1423 (Bacillus subtilis)

NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVL
LDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHF
AKPFDIDEIRDAVKKYLPL

3D structure

• PDB: 1srr Crystal structure of a phosphatase-resistant mutant of sporulation response regulator Spo0F from Bacillus subtilis.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 2.7.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D11 D54 K56	D9 D52 K54

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016301 kinase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000160 phosphorelay signal transduction system
• GO:0016310 phosphorylation
• GO:0030435 sporulation resulting in formation of a cellular spore

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1srr, PDBe:1srr, PDBj:1srr
• PDBsum: 1srr
• PubMed: 8805550
• UniProt: P06628|SP0F_BACSU Sporulation initiation phosphotransferase F (Gene Name=spo0F)