Structure of PDB 1slt Chain A

Receptor sequence

>1sltA (length=133) Species: 9913 (Bos taurus)

CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNA
HGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLP
DGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE

3D structure

• PDB: 1slt Structure of S-lectin, a developmentally regulated vertebrate beta-galactoside-binding protein.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAL	A	H44 R48 N61 W68 E71	H43 R47 N60 W67 E70

Gene Ontology

Molecular Function

• GO:0030246 carbohydrate binding
• GO:0030395 lactose binding
• GO:0043236 laminin binding

Biological Process

• GO:0006915 apoptotic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1slt, PDBe:1slt, PDBj:1slt
• PDBsum: 1slt
• PubMed: 8108426
• UniProt: P11116|LEG1_BOVIN Galectin-1 (Gene Name=LGALS1)