Structure of PDB 1sfd Chain A |
>1sfdA (length=105) Species: 266 (Paracoccus denitrificans) [Search protein sequence] |
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREA MPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTFHPFMRG KVVVE |
|
PDB | 1sfd Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper. |
Chain | A |
Resolution | 0.99 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H53 C92 H95 |
H53 C92 H95 |
|
|
|
|