Structure of PDB 1seh Chain A

Receptor sequence
>1sehA (length=140) Species: 562 (Escherichia coli) [Search protein sequence]
MMKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTL
VPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMIS
VWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVEDFDATR
3D structure
PDB1seh Structural Insights into the Catalytic Mechanism of Phosphate Ester Hydrolysis by dUTPase
ChainA
Resolution1.47 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A29 R71 G73 I80 D90
Catalytic site (residue number reindexed from 1) A29 R71 G73 I80 D90
Enzyme Commision number 3.6.1.23: dUTP diphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UMP A M68 N84 G87 L88 I89 D90 Y93 M98 M68 N84 G87 L88 I89 D90 Y93 M98
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004170 dUTP diphosphatase activity
GO:0016787 hydrolase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006226 dUMP biosynthetic process
GO:0009117 nucleotide metabolic process
GO:0046081 dUTP catabolic process
GO:0070207 protein homotrimerization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1seh, PDBe:1seh, PDBj:1seh
PDBsum1seh
PubMed15208312
UniProtP06968|DUT_ECOLI Deoxyuridine 5'-triphosphate nucleotidohydrolase (Gene Name=dut)

[Back to BioLiP]