Structure of PDB 1se0 Chain A

Receptor sequence

>1se0A (length=97) Species: 7227 (Drosophila melanogaster)

NDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIG
SWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYD

3D structure

• PDB: 1se0 Molecular mechanisms of DrICE inhibition by DIAP1 and removal of inhibition by Reaper, Hid and Grim.
• Chain: A
• Resolution: 1.75 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	C83 G84 V85 E86 I87 G88 S89 D94 E99 W103	C45 G46 V47 E48 I49 G50 S51 D56 E61 W65
BS02	ZN	A	C80 C83 H100 C107	C42 C45 H62 C69

External links

• PDB: RCSB:1se0, PDBe:1se0, PDBj:1se0
• PDBsum: 1se0
• PubMed: 15107838
• UniProt: Q24306|DIAP1_DROME Death-associated inhibitor of apoptosis 1 (Gene Name=Diap1)