Structure of PDB 1s9d Chain A

Receptor sequence
>1s9dA (length=155) Species: 9913 (Bos taurus) [Search protein sequence]
MRILMVGLDAAGKTTILYKLKTIPTIGFNVETVEYKNISFTVWDVGGQDK
IRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLV
FANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWL
SNQLR
3D structure
PDB1s9d Structural Snapshots of the Mechanism and Inhibition of a Guanine Nucleotide Exchange Factor
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q71
Catalytic site (residue number reindexed from 1) Q48
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A A27 G29 K30 T31 T32 N126 K127 D129 L130 C159 A160 T161 A10 G12 K13 T14 T15 N103 K104 D106 L107 C136 A137 T138
BS02 AFB A W66 D67 W78 Y81 W43 D44 W55 Y58
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0002090 regulation of receptor internalization
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
GO:0060292 long-term synaptic depression
GO:0097061 dendritic spine organization
Cellular Component
GO:0000139 Golgi membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0042583 chromaffin granule
GO:0043005 neuron projection
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s9d, PDBe:1s9d, PDBj:1s9d
PDBsum1s9d
PubMed14654833
UniProtP84080|ARF1_BOVIN ADP-ribosylation factor 1 (Gene Name=ARF1)

[Back to BioLiP]