Structure of PDB 1s7s Chain A |
>1s7sA (length=276) Species: 10090 (Mus musculus) [Search protein sequence] |
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRAR WMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISG CEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQA GEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVT LRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVP LGKEQYYTCHVYHQGLPEPLTLRWEP |
|
PDB | 1s7s Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition. |
Chain | A |
Resolution | 1.99 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0001913 |
T cell mediated cytotoxicity |
GO:0001916 |
positive regulation of T cell mediated cytotoxicity |
GO:0002474 |
antigen processing and presentation of peptide antigen via MHC class I |
GO:0002485 |
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent |
GO:0006955 |
immune response |
GO:0010977 |
negative regulation of neuron projection development |
GO:0019882 |
antigen processing and presentation |
GO:0042590 |
antigen processing and presentation of exogenous peptide antigen via MHC class I |
GO:0042742 |
defense response to bacterium |
GO:0048839 |
inner ear development |
|
|