Structure of PDB 1s69 Chain A

Receptor sequence
>1s69A (length=123) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFL
TYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVP
EDLIAEVAAVAGAPAHKRDVLNQ
3D structure
PDB1s69 Crystallographic analysis of synechocystis cyanoglobin reveals the structural changes accompanying ligand binding in a hexacoordinate hemoglobin.
ChainA
Resolution1.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CYN A Y22 Q43 Q47 Y21 Q42 Q46
BS02 HEM A I31 F34 F35 V38 Q43 Q47 F50 Y61 G63 R64 M66 H70 L73 L79 F84 V87 H117 I30 F33 F34 V37 Q42 Q46 F49 Y60 G62 R63 M65 H69 L72 L78 F83 V86 H116
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0008379 thioredoxin peroxidase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0034599 cellular response to oxidative stress
GO:0045454 cell redox homeostasis
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s69, PDBe:1s69, PDBj:1s69
PDBsum1s69
PubMed15289104
UniProtP73925|TRHBN_SYNY3 Group 1 truncated hemoglobin GlbN (Gene Name=glbN)

[Back to BioLiP]