Structure of PDB 1s5l Chain A

Receptor sequence

>1s5lA (length=333) Species: 146786 (Thermosynechococcus vestitus) [Search protein sequence]

NLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDID
GIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGP
YQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIY
PIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALF
CAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQ
YASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKG
NVINTWADIINRANLGMEVMHERNAHNFPLDLA

3D structure

PDB

1s5l Architecture of the Photosynthetic Oxygen-Evolving Center

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE	A	H215 H272	H204 H261
BS02	BCT	A	D170 A344	D159 A333
BS03	OEC	A	D170 E189 H332 E333 D342 A344	D159 E178 H321 E322 D331 A333
BS04	CLA	A	P150 S153 A154 M183 I184 F186 I192 L193 H198 G201 V202 F206 T286 A287 I290	P139 S142 A143 M172 I173 F175 I181 L182 H187 G190 V191 F195 T275 A276 I279
BS05	CLA	A	F158 M172 T179 F180 F182 M183	F147 M161 T168 F169 F171 M172
BS06	CLA	A	Q199 V202 A203 Y262 A263 W278	Q188 V191 A192 Y251 A252 W267
BS07	PHO	A	L41 A44 T45 Y126 A146 Y147 F158 L174	L30 A33 T34 Y115 A135 Y136 F147 L163
BS08	CLA	A	P39 T40 F93 Y94 P95 I96 W97 L114 H118	P28 T29 F82 Y83 P84 I85 W86 L103 H107
BS09	CLA	A	F117 L159 I163 F168	F106 L148 I152 F157
BS10	BCT	A	H215 Y246 H272	H204 Y235 H261
BS11	PHO	A	F206 L210 M214	F195 L199 M203

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1s5l, PDBe:1s5l, PDBj:1s5l
PDBsum	1s5l
PubMed	14764885
UniProt	P0A444\|PSBA1_THEVB Photosystem II protein D1 1 (Gene Name=psbA1)

[Back to BioLiP]