Structure of PDB 1s24 Chain A |
>1s24A (length=56) Species: 301 (Pseudomonas oleovorans) [Search protein sequence] |
AYLKWICITCGHIYDEALGDEAEGFTPGTRFEDIPDDWCCPDCGATKEDY VLYEEK |
|
PDB | 1s24 Solution structure of the two-iron rubredoxin of Pseudomonas oleovorans determined by NMR spectroscopy and solution X-ray scattering and interactions with rubredoxin reductase. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CD |
A |
C7 C10 C40 C43 |
C7 C10 C40 C43 |
|
|
|
|