Structure of PDB 1s1e Chain A

Receptor sequence
>1s1eA (length=181) Species: 9606 (Homo sapiens) [Search protein sequence]
GLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDA
STYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDIN
KDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKD
GIVTLDEFLESCQEDDNIMRSLQLFQNVMVE
3D structure
PDB1s1e Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D135 N137 D139 Y141 E146 D98 N100 D102 Y104 E109
BS02 CA A D183 N185 D187 I189 E194 D146 N148 D150 I152 E157
Gene Ontology
Molecular Function
GO:0005267 potassium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0015459 potassium channel regulator activity
GO:0044325 transmembrane transporter binding
GO:0046872 metal ion binding
Biological Process
GO:0006936 muscle contraction
GO:0007268 chemical synaptic transmission
GO:0008016 regulation of heart contraction
GO:0071805 potassium ion transmembrane transport
GO:0086009 membrane repolarization
GO:0097623 potassium ion export across plasma membrane
GO:1901379 regulation of potassium ion transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0009898 cytoplasmic side of plasma membrane
GO:0030425 dendrite
GO:0034702 monoatomic ion channel complex
GO:0042995 cell projection
GO:0045202 synapse
GO:0071196 Kv4.3-KChIP1 channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s1e, PDBe:1s1e, PDBj:1s1e
PDBsum1s1e
PubMed14980207
UniProtQ9NZI2|KCIP1_HUMAN A-type potassium channel modulatory protein KCNIP1 (Gene Name=KCNIP1)

[Back to BioLiP]