Structure of PDB 1s0n Chain A

Receptor sequence

>1s0nA (length=341) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 1s0n Snapshots of Replication through an Abasic Lesion; Structural Basis for Base Substitutions and Frameshifts.
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S103 E106 K152 G185 G187 I189 T190 S297	S103 E106 K152 G185 G187 I189 T190 S297
BS02	dna	A	V32 F33 F37 A42 E219 A220 R242 K243 S244 G246 R247 I248 T250 R332 R336	V32 F33 F37 A42 E219 A220 R242 K243 S244 G246 R247 I248 T250 R332 R336
BS03	CA	A	D7 E106	D7 E106
BS04	CA	A	D7 F8 D105	D7 F8 D105
BS05	CA	A	A181 I186	A181 I186
BS06	DCP	A	Y10 Y12 A44 T45 Y48 R51 A57 D105 K159	Y10 Y12 A44 T45 Y48 R51 A57 D105 K159

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1s0n, PDBe:1s0n, PDBj:1s0n
• PDBsum: 1s0n
• PubMed: 15023344
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)