Structure of PDB 1rzy Chain A

Receptor sequence
>1rzyA (length=114) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
PGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQ
ISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVH
LHVLGGRQMNWPPG
3D structure
PDB1rzy Biochemical, crystallographic, and mutagenic characterization of hint, the AMP-lysine hydrolase, with novel substrates and inhibitors
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.22.-
3.9.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 5AS A I22 F41 D43 I44 N99 G105 Q106 S107 H112 H114 I10 F29 D31 I32 N87 G93 Q94 S95 H100 H102 MOAD: Ki=1.25uM
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0008234 cysteine-type peptidase activity
GO:0016787 hydrolase activity
GO:0016929 deSUMOylase activity
GO:0043530 adenosine 5'-monophosphoramidase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0009154 purine ribonucleotide catabolic process
GO:0016926 protein desumoylation
GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
Cellular Component
GO:0000118 histone deacetylase complex
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rzy, PDBe:1rzy, PDBj:1rzy
PDBsum1rzy
PubMed14982931
UniProtP80912|HINT1_RABIT Adenosine 5'-monophosphoramidase HINT1 (Gene Name=HINT1)

[Back to BioLiP]