Structure of PDB 1rzl Chain A |
>1rzlA (length=91) Species: 4530 (Oryza sativa) [Search protein sequence] |
ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNC LKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS |
|
PDB | 1rzl Rice non-specific lipid transfer protein: the 1.6 A crystal structure in the unliganded state reveals a small hydrophobic cavity. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SO4 |
A |
T2 G4 |
T2 G4 |
|
|
|
|