Structure of PDB 1rz6 Chain A

Receptor sequence

>1rz6A (length=312) Species: 2743 (Marinobacter nauticus)

DNLMERANSMFEPIPKYPPVIDGNELTQAKVELGKMEFFEPRLSSSHLIS
CNTCHNVGLGGDDELPTSIGHGWQKGPRNSPTVFNAVFNAAQFWDGRAAD
LAEQAKGPVQAGVEMSSTPDRVVATLKSMPEYIERFEDAFPGQENPVTFD
NMAVAIEAYEATLITPEAPFDKYLRGDTSALNESEKEGLALFMDRGCTAC
HSGVNLGGQNYYPFGLVAKKGRFSVTETASDEYVFRASPLRNIELTAPYF
HSGAVWSLEEAVAVMGTAQLGTELNNDEVKSIVAFLKTLTGNVPEVTYPV
LPPSTANTPKPV

3D structure

• PDB: 1rz6 Structural basis for the mechanism of Ca(2+) activation of the di-heme cytochrome c peroxidase from Pseudomonas nautica 617.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E114
• Catalytic site (residue number reindexed from 1): E114
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C51 C54 H55 I69 H71 R78 S80 P81 Q92 F93 P108 G112 E160 R246	C51 C54 H55 I69 H71 R78 S80 P81 Q92 F93 P108 G112 E160 R236
BS02	HEC	A	C197 C200 H201 F214 G215 L216 R246 A247 S248 L250 Y259 F260 H261 M275	C197 C200 H201 F214 G215 L216 R236 A237 S238 L240 Y249 F250 H251 M265

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1rz6, PDBe:1rz6, PDBj:1rz6
• PDBsum: 1rz6
• PubMed: 15274917
• UniProt: P83787