Structure of PDB 1rz5 Chain A

Receptor sequence

>1rz5A (length=309) Species: 2743 (Marinobacter nauticus)

DNLMERANSMFEPIPKYPPVIDGNELTQAKVELGKMEFFEPRLSSSHLIS
CNTCHNVGLGGDDELPTSIGHGWQKGPRNSPTVFNAVFNAAQFWDGRAKG
PVQAGVEMSSTPDRVVATLKSMPEYIERFEDAFPGQENPVTFDNMAVAIE
AYEATLITPEAPFDKYLRGDTSALNESEKEGLALFMDRGCTACHSGVNLG
GQNYYPFGLVAKKGRFSVTETASDEYVFRASPLRNIELTAPYFHSGAVWS
LEEAVAVMGTAQLGTELNNDEVKSIVAFLKTLTGNVPEVTYPVLPPSTAN
TPKPVDMIP

3D structure

• PDB: 1rz5 Structural basis for the mechanism of Ca(2+) activation of the di-heme cytochrome c peroxidase from Pseudomonas nautica 617.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E114
• Catalytic site (residue number reindexed from 1): E107
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	N79 T256 P258	N79 T239 P241
BS02	HEC	A	C51 C54 H55 I69 R78 S80 P81 A86 N89 F93 W94 P108 G112 E160 R246	C51 C54 H55 I69 R78 S80 P81 A86 N89 F93 W94 P101 G105 E153 R229
BS03	HEC	A	W94 C197 C200 H201 F214 G215 F245 R246 A247 S248 I253 Y259 F260 H261 M275	W94 C190 C193 H194 F207 G208 F228 R229 A230 S231 I236 Y242 F243 H244 M258

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1rz5, PDBe:1rz5, PDBj:1rz5
• PDBsum: 1rz5
• PubMed: 15274917
• UniProt: P83787