Structure of PDB 1rwj Chain A

Receptor sequence

>1rwjA (length=81) Species: 35554 (Geobacter sulfurreducens)

KGMTPPKTVNFKMKGVADAAFSHEFHLGMYKCNECHTKLFAYKAGAKRFT
MADMDKGKSCGACHNGKDAFSSASDCGKCHP

3D structure

• PDB: 1rwj Structure of a novel c7-type three-heme cytochrome domain from a multidomain cytochrome c polymer.
• Chain: A
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	M3 P5 P6 F11 F21 H23 H26 L27 C32 C35 H36 F40 Y42 K43 A44 G45	M3 P5 P6 F11 F21 H23 H26 L27 C32 C35 H36 F40 Y42 K43 A44 G45
BS02	HEC	A	F21 F25 H26 M29 Y30 C60 C63 H64 A69 F70 K78 C79	F21 F25 H26 M29 Y30 C60 C63 H64 A69 F70 K78 C79
BS03	HEC	A	F11 M13 V16 A19 R48 F49 T50 M51 M54 H64 S72 C76 C79 H80	F11 M13 V16 A19 R48 F49 T50 M51 M54 H64 S72 C76 C79 H80

External links

• PDB: RCSB:1rwj, PDBe:1rwj, PDBj:1rwj
• PDBsum: 1rwj
• PubMed: 15133162
• UniProt: Q74BP5