Structure of PDB 1rv1 Chain A

Receptor sequence
>1rv1A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
ETLVRPKPELLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHI
VYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV
3D structure
PDB1rv1 In vivo activation of the p53 pathway by small-molecule antagonists of MDM2.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 IMZ A L54 G58 I61 M62 Q72 H73 V93 H96 Y100 L30 G34 I37 M38 Q48 H49 V69 H72 Y76 MOAD: ic50=0.14uM
PDBbind-CN: -logKd/Ki=6.85,IC50=0.14uM
BindingDB: IC50=140nM
BS02 IMZ A M50 Y100 M26 Y76 MOAD: ic50=0.14uM
PDBbind-CN: -logKd/Ki=6.85,IC50=0.14uM
BindingDB: IC50=140nM
BS03 IMZ A L54 H96 Y100 L30 H72 Y76 MOAD: ic50=0.14uM
PDBbind-CN: -logKd/Ki=6.85,IC50=0.14uM
BindingDB: IC50=140nM
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rv1, PDBe:1rv1, PDBj:1rv1
PDBsum1rv1
PubMed14704432
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]