Structure of PDB 1rs8 Chain A

Receptor sequence

>1rs8A (length=406) Species: 9913 (Bos taurus)

GPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLVLPRPPAEQLL
SQARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGA
KQAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNL
RSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELC
IQHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVPLEHPTLEWFA
ALGLRWYALPAVSNMLLEIGGLEFSAAPFSGWYMSTEIGTRNLCDPHRYN
ILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIVDHHAAT
VSFMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFR
YQPDPW

3D structure

• PDB: 1rs8 Structures of the neuronal and endothelial nitric oxide synthase heme domain with D-nitroarginine-containing dipeptide inhibitors bound.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C186 R189 W358 E363
• Catalytic site (residue number reindexed from 1): C110 R113 W282 E287
• Enzyme Commision number: 1.14.13.39: nitric-oxide synthase (NADPH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C96 C101	C30 C35
BS02	HEM	A	W180 R185 C186 M341 F355 S356 W358 M360 E363 W449 F475 Y477	W104 R109 C110 M265 F279 S280 W282 M284 E287 W373 F399 Y401
BS03	H4B	A	S104 R367 A448 W449	S38 R291 A372 W373
BS04	DP2	A	Q249 P336 V338 S356 G357 W358 E363 Y477	Q173 P260 V262 S280 G281 W282 E287 Y401
BS05	H4B	A	W447 F462 E465	W371 F386 E389

Gene Ontology

Molecular Function

• GO:0004517 nitric-oxide synthase activity
• GO:0020037 heme binding

Biological Process

• GO:0006809 nitric oxide biosynthetic process

External links

• PDB: RCSB:1rs8, PDBe:1rs8, PDBj:1rs8
• PDBsum: 1rs8
• PubMed: 15122883
• UniProt: P29473|NOS3_BOVIN Nitric oxide synthase 3 (Gene Name=NOS3)