Structure of PDB 1rpu Chain A

Receptor sequence
>1rpuA (length=138) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence]
DTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDENPLGFKESWG
FGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSI
RFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEV
3D structure
PDB1rpu Size selective recognition of siRNA by an RNA silencing suppressor
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A R11 W39 T40 R43 K67 S113 R115 S120 R3 W31 T32 R35 K53 S99 R101 S106 PDBbind-CN: Kd=0.17nM
BS02 rna A R18 P37 W39 W42 K60 Y73 Q107 V108 G109 G125 G126 R10 P29 W31 W34 K46 Y59 Q93 V94 G95 G111 G112 PDBbind-CN: Kd=0.17nM
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rpu, PDBe:1rpu, PDBj:1rpu
PDBsum1rpu
PubMed14697199
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]