Structure of PDB 1rm1 Chain A

Receptor sequence
>1rm1A (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
3D structure
PDB1rm1 High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A T73 F116 S118 V122 Q158 N159 L189 F190 I194 R196 L205 T215 T13 F56 S58 V62 Q98 N99 L129 F130 I134 R136 L145 T155
BS02 dna A Q68 N69 F99 I103 R105 T112 L114 T124 P191 F207 S209 K211 V213 Q8 N9 F39 I43 R45 T52 L54 T64 P131 F147 S149 K151 V153
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0001016 RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0001092 TFIIA-class transcription factor complex binding
GO:0001179 RNA polymerase I general transcription initiation factor binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0097718 disordered domain specific binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006352 DNA-templated transcription initiation
GO:0006359 regulation of transcription by RNA polymerase III
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rm1, PDBe:1rm1, PDBj:1rm1
PDBsum1rm1
PubMed
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]