Structure of PDB 1rk8 Chain A

Receptor sequence

>1rk8A (length=87) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

PQRSVGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGY
ALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKG

3D structure

PDB

1rk8 Molecular insights into the interaction of PYM with the Mago-Y14 core of the exon junction complex

Chain

Resolution

1.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D87 E91	D21 E25
BS02	CA	A	D87 E88	D21 E22

Gene Ontology

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0000398	mRNA splicing, via spliceosome
GO:0006396	RNA processing
GO:0006397	mRNA processing
GO:0007294	germarium-derived oocyte fate determination
GO:0007310	oocyte dorsal/ventral axis specification
GO:0007314	oocyte anterior/posterior axis specification
GO:0007317	regulation of pole plasm oskar mRNA localization
GO:0008380	RNA splicing
GO:0045451	pole plasm oskar mRNA localization
GO:0046595	establishment of pole plasm mRNA localization
GO:0051028	mRNA transport
GO:0051170	import into nucleus
GO:0051663	oocyte nucleus localization involved in oocyte dorsal/ventral axis specification

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0035145	exon-exon junction complex
GO:0042564	NLS-dependent protein nuclear import complex
GO:0071013	catalytic step 2 spliceosome

External links

PDB	RCSB:1rk8, PDBe:1rk8, PDBj:1rk8
PDBsum	1rk8
PubMed	14968132
UniProt	Q9V535\|RBM8A_DROME RNA-binding protein 8A (Gene Name=tsu)