Structure of PDB 1rfj Chain A

Receptor sequence
>1rfjA (length=148) Species: 4113 (Solanum tuberosum) [Search protein sequence]
MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQ
DMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGF
ISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMA
3D structure
PDB1rfj Structure of potato calmodulin PCM6: the first report of the three-dimensional structure of a plant calmodulin.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V36
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D20 D22 D24 C26 E31 D21 D23 D25 C27 E32
BS02 CA A D56 D58 N60 T62 E67 D57 D59 N61 T63 E68
BS03 CA A D93 D95 N97 F99 E104 D94 D96 N98 F100 E105
BS04 CA A D129 D131 D133 Q135 E140 D130 D132 D134 Q136 E141
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0030234 enzyme regulator activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:1rfj, PDBe:1rfj, PDBj:1rfj
PDBsum1rfj
PubMed15213382
UniProtQ7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 (Gene Name=PCM5)

[Back to BioLiP]