Structure of PDB 1rem Chain A

Receptor sequence

>1remA (length=130) Species: 9606 (Homo sapiens)

KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDR
STDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVV
RDPQGIRAWVAWRNRCQNRDVRQYVQGCGV

3D structure

• PDB: 1rem X-ray structure of human lysozyme labelled with 2',3'-epoxypropyl beta-glycoside of man-beta1,4-GlcNAc. Structural change and recognition specificity at subsite B.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E35 N46 D49 S51 D53 N60
• Catalytic site (residue number reindexed from 1): E35 N46 D49 S51 D53 N60
• Enzyme Commision number: 3.2.1.17: lysozyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BMA	A	D102 Q104	D102 Q104

Gene Ontology

Molecular Function

• GO:0003796 lysozyme activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0042802 identical protein binding

Biological Process

• GO:0006954 inflammatory response
• GO:0019730 antimicrobial humoral response
• GO:0031640 killing of cells of another organism
• GO:0042742 defense response to bacterium
• GO:0050829 defense response to Gram-negative bacterium
• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0035578 azurophil granule lumen
• GO:0035580 specific granule lumen
• GO:0070062 extracellular exosome
• GO:1904724 tertiary granule lumen

External links

• PDB: RCSB:1rem, PDBe:1rem, PDBj:1rem
• PDBsum: 1rem
• PubMed: 9757098
• UniProt: P61626|LYSC_HUMAN Lysozyme C (Gene Name=LYZ)