Structure of PDB 1r66 Chain A

Receptor sequence

>1r66A (length=322) Species: 54571 (Streptomyces venezuelae)

MRLLVTGGAGFIGSHFVRQLLAGAYPDVPADEVIVLDSLTYAGNRANLAP
VDADPRLRFVHGDIRDAGLLARELRGVDAIVHFAAESHVDRSIAGASVFT
ETNVQGTQTLLQCAVDAGVGRVVHVSTDEVYGSIDSGSWTESSPLEPNSP
YAASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPEKLIPLFVTNLL
DGGTLPLYGDGANVREWVHTDDHCRGIALVLAGGRAGEIYHIGGGLELTN
RELTGILLDSLGADWSSVRKVADRKGHDLRYSLDGGKIERELGYRPQVSF
ADGLARTVRWYRENRGWWEPLK

3D structure

• PDB: 1r66 High Resolution X-ray Structure of dTDP-Glucose 4,6-Dehydratase from Streptomyces venezuelae
• Chain: A
• Resolution: 1.44 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T127 D128 E129 Y151 K155
• Catalytic site (residue number reindexed from 1): T127 D128 E129 Y151 K155
• Enzyme Commision number: 4.2.1.46: dTDP-glucose 4,6-dehydratase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G10 F11 I12 D37 S38 L39 T40 G43 D63 I64 F83 A84 A85 S87 T102 V125 S126 Y151 K155 N181	G10 F11 I12 D37 S38 L39 T40 G43 D63 I64 F83 A84 A85 S87 T102 V125 S126 Y151 K155 N181
BS02	TYD	A	H88 E129 N180 K190 L191 P206 Y208 R215 N250 R274 H277	H88 E129 N180 K190 L191 P206 Y208 R215 N250 R274 H277

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008460 dTDP-glucose 4,6-dehydratase activity
• GO:0016491 oxidoreductase activity
• GO:0016829 lyase activity

Biological Process

• GO:0009225 nucleotide-sugar metabolic process

External links

• PDB: RCSB:1r66, PDBe:1r66, PDBj:1r66
• PDBsum: 1r66
• PubMed: 14570895
• UniProt: Q9ZGH3