Structure of PDB 1r3e Chain A

Receptor sequence

>1r3eA (length=305) Species: 2336 (Thermotoga maritima)

MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGV
NQGTRILEFYKDLKKVYWVKMRLGLITETFDITGEVVEERECNVTEEEIR
EAIFSFVGEYDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIW
DVNIEGRDVSFRVEVSPGTYIRSLCMDIGYKLGCGATAVELVRESVGPHT
IEESLNVFEAAPEEIENRIIPLEKCLEWLPRVVVHQESTKMILNGSQIHL
EMLKEWDGFKKGEVVRVFNEEGRLLALAEAERNSSFLETLRKERVLTLRK
VFNTR

3D structure

• PDB: 1r3e Crystal Structure of tRNA Pseudouridine Synthase TruB and Its RNA Complex: RNA Recognition Through a Combination of Rigid Docking and Induced Fit
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 5.4.99.25: tRNA pseudouridine(55) synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	H26 K40 V41 G42 H43 G45 T46 D48 P49 T63 E67 K70 K74 Y76 T88 D90 S127 A128 K129 K130 G133 R135 Y137 R141 Y179 I180 R181 L200 K313	H17 K31 V32 G33 H34 G36 T37 D39 P40 T54 E58 K61 K65 Y67 T79 D81 S118 A119 K120 K121 G124 R126 Y128 R132 Y170 I171 R172 L191 K300
BS02	rna	A	R64 G254 Q256 K313 V314	R55 G245 Q247 K300 V301

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0009982 pseudouridine synthase activity
• GO:0016853 isomerase activity
• GO:0140098 catalytic activity, acting on RNA
• GO:0160148 tRNA pseudouridine(55) synthase activity

Biological Process

• GO:0001522 pseudouridine synthesis
• GO:0006396 RNA processing
• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0009451 RNA modification
• GO:0031119 tRNA pseudouridine synthesis
• GO:1990481 mRNA pseudouridine synthesis

External links

• PDB: RCSB:1r3e, PDBe:1r3e, PDBj:1r3e
• PDBsum: 1r3e
• PubMed: 14566049
• UniProt: Q9WZW0|TRUB_THEMA tRNA pseudouridine synthase B (Gene Name=truB)