Structure of PDB 1r30 Chain A

Receptor sequence

>1r30A (length=312) Species: 562 (Escherichia coli)

RPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGAC
PEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWK
NPHERDMPYLEQMVQGVKAMGLEACMTLGTLSESQAQRLANAGLDYYNHN
LDTSPEFYGNIITTRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVKDRA
GLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVARIM
MPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQ
LFRKLGLNPQQT

3D structure

• PDB: 1r30 Crystal structure of biotin synthase, an S-adenosylmethionine-dependent radical enzyme.
• Chain: A
• Resolution: 3.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C53 C57 C60 C97 C128 C188 R260
• Catalytic site (residue number reindexed from 1): C50 C54 C57 C94 C125 C185 R257
• Enzyme Commision number: 2.8.1.6: biotin synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAM	A	Y59 P61 G132 N153 D155 R173 I192 L224 V225 L291	Y56 P58 G129 N150 D152 R170 I189 L221 V222 L288
BS02	SF4	A	C53 E55 C57 C60 S63	C50 E52 C54 C57 S60
BS03	FES	A	C97 C128 C188 R260	C94 C125 C185 R257
BS04	DTB	A	L45 N222 A263 L291 T292 T293	L42 N219 A260 L288 T289 T290

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004076 biotin synthase activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009102 biotin biosynthetic process
• GO:0042364 water-soluble vitamin biosynthetic process
• GO:0044272 sulfur compound biosynthetic process

External links

• PDB: RCSB:1r30, PDBe:1r30, PDBj:1r30
• PDBsum: 1r30
• PubMed: 14704425
• UniProt: P12996|BIOB_ECOLI Biotin synthase (Gene Name=bioB)