Structure of PDB 1r2m Chain A |
>1r2mA (length=70) Species: 51453 (Trichoderma reesei) [Search protein sequence] |
AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKP LCCVAPVADQALLCQKAIGT |
|
PDB | 1r2m Atomic resolution structure of the HFBII hydrophobin, a self-assembling amphiphile. |
Chain | A |
Resolution | 1.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
D25 Q60 |
D25 Q60 |
|
|
|
|