Structure of PDB 1qxn Chain A |
>1qxnA (length=137) Species: 844 (Wolinella succinogenes) [Search protein sequence] |
ADMGEKFDATFKAQVKAAKADMVMLSPKDAYKLLQENPDITLIDVRDPDE LKAMGKPDVKNYKHMSRGKLEPLLAKSGLDPEKPVVVFCKTAARAALAGK TLREYGFKTIYNSEGGMDKWLEEGLPSLDRSHHHHHH |
|
PDB | 1qxn Solution Structure of the 30 kDa Polysulfide-Sulfur Transferase Homodimer from Wolinella succinogenes |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PS5 |
A |
C89 T91 A92 |
C89 T91 A92 |
|
|
|
|