Structure of PDB 1qua Chain A |
>1quaA (length=197) Species: 36307 (Deinagkistrodon acutus) [Search protein sequence] |
PAPQTSIELFLIVDHSMYAKYNSNSSKITTTLKARVNIMNAIYSSLNLVI TLSGIEMWSAADLITVQSSSRNTLKLFASWRETDLLKRTSNDNAQLLTAT NFNGNTVGLAYLKTMCNSKYSVGLIQDHSAIPLLMAVTMAHELGHNLGMN HDGAGCSCATCIMAPVLSSGPAKSFSDCSKHDYQSFLTIHKPQCLLN |
|
PDB | 1qua Structure of acutolysin-C, a haemorrhagic toxin from the venom of Agkistrodon acutus, providing further evidence for the mechanism of the pH-dependent proteolytic reaction of zinc metalloproteinases. |
Chain | A |
Resolution | 2.2 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H142 H146 H152 |
H141 H145 H151 |
|
|
|
|