Structure of PDB 1qs7 Chain A

Receptor sequence

>1qs7A (length=145) Species: 562 (Escherichia coli) [Search protein sequence]

LTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAA
ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK

3D structure

PDB

1qs7 Target Enzyme Recognition by Calmodulin: 2.4 A Structure of a Calmodulin- Peptide Complex

Chain

Resolution

1.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	V35
Catalytic site (residue number reindexed from 1)	V32
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	E11 F12 E14 A15 F19 M51 L71 M72 R74 M76 E84 A88 V91 F92 L105 M109 K115 E120 M124 F141 M145 A147 K148	E8 F9 E11 A12 F16 M48 L68 M69 R71 M73 E81 A85 V88 F89 L102 M106 K112 E117 M121 F138 M142 A144 K145
BS02	CA	A	D20 D22 D24 T26 E31	D17 D19 D21 T23 E28
BS03	CA	A	D56 D58 N60 T62 E67	D53 D55 N57 T59 E64
BS04	CA	A	D93 D95 N97 F99 E104	D90 D92 N94 F96 E101
BS05	CA	A	D129 D131 D133 Q135 E140	D126 D128 D130 Q132 E137

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0046872	metal ion binding

External links