Structure of PDB 1qn0 Chain A

Receptor sequence

>1qn0A (length=112) Species: 879 (Megalodesulfovibrio gigas) [Search protein sequence]

VDVPADGAKIDFIAGGEKNLTVVFNHSTHKDVKCDDCHHQPGDKQYAGCT
TDGCHNILDKADKSVNSWYKVVHDAKGGAKPTCISCHKDKAGDDKELKKK
LTGCKGSACHPS

3D structure

PDB

1qn0 Structural Basis for the Network of Functional Cooperativities in Cytochrome C3 from Desulfovibrio Gigas: Solution Structures of the Oxidised and Reduced States

Chain

Resolution

N/A

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	V3 P4 I10 F12 F24 H26 V32 K33 C34 C37 H38 Y46	V3 P4 I10 F12 F24 H26 V32 K33 C34 C37 H38 Y46
BS02	HEC	A	H39 Q40 C49 C54 H55 V65	H39 Q40 C49 C54 H55 V65
BS03	HEC	A	F24 T28 H29 C83 C86 H87 K90 L101 A108	F24 T28 H29 C83 C86 H87 K90 L101 A108
BS04	HEC	A	I10 D11 F12 L20 V22 K60 W68 Y69 V72 H73 C83 H87 L101 T102 C104 C109 H110	I10 D11 F12 L20 V22 K60 W68 Y69 V72 H73 C83 H87 L101 T102 C104 C109 H110

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0009061	anaerobic respiration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1qn0, PDBe:1qn0, PDBj:1qn0
PDBsum	1qn0
PubMed	10756105
UniProt	P00133\|CYC3_MEGG1 Cytochrome c3

[Back to BioLiP]