Structure of PDB 1qjb Chain A

Receptor sequence

>1qjbA (length=228) Species: 9606 (Homo sapiens) [Search protein sequence]

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKN
VVGARRSSWRVVSSIEQKEKKQQMAREYREKIETELRDICNDVLSLLEKF
LIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFE
ISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELD
TLSEESYKDSTLIMQLLRDNLTLWTSDT

3D structure

PDB

1qjb Structural Analysis of 14-3-3 Phosphopeptide Complexes Identifies a Dual Role for the Nuclear Export Signal of 14-3-3 in Ligand Binding

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K49 R56 K120 R127 Y128 L172 N173 V176 E180 I217 N224 L227 W228	K49 R56 K116 R123 Y124 L168 N169 V172 E176 I213 N220 L223 W224

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0019901	protein kinase binding
GO:0019904	protein domain specific binding
GO:0031625	ubiquitin protein ligase binding
GO:0042802	identical protein binding
GO:0044325	transmembrane transporter binding
GO:0045296	cadherin binding
GO:0050815	phosphoserine residue binding
GO:0140297	DNA-binding transcription factor binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001525	angiogenesis
GO:0003016	respiratory system process
GO:0006468	protein phosphorylation
GO:0006605	protein targeting
GO:0007165	signal transduction
GO:0008039	synaptic target recognition
GO:0008104	protein localization
GO:0030324	lung development
GO:0031647	regulation of protein stability
GO:0035148	tube formation
GO:0042149	cellular response to glucose starvation
GO:0043066	negative regulation of apoptotic process
GO:0043067	regulation of programmed cell death
GO:0045824	negative regulation of innate immune response
GO:0051683	establishment of Golgi localization
GO:0070371	ERK1 and ERK2 cascade
GO:0070372	regulation of ERK1 and ERK2 cascade
GO:0090128	regulation of synapse maturation
GO:0090168	Golgi reassembly
GO:1900181	negative regulation of protein localization to nucleus
GO:1904262	negative regulation of TORC1 signaling

	Cellular Component
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005925	focal adhesion
GO:0031982	vesicle
GO:0042470	melanosome
GO:0070062	extracellular exosome
GO:0072562	blood microparticle
GO:0098686	hippocampal mossy fiber to CA3 synapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1qjb, PDBe:1qjb, PDBj:1qjb
PDBsum	1qjb
PubMed	10488331
UniProt	P63104\|1433Z_HUMAN 14-3-3 protein zeta/delta (Gene Name=YWHAZ)

[Back to BioLiP]