Structure of PDB 1qhj Chain A

Receptor sequence

>1qhjA (length=228) Species: 2242 (Halobacterium salinarum)

TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAF
TMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDAD
QGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFF
GFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIE
TLLFMVLDVSAKVGFGLILLRSRAIFGE

3D structure

• PDB: 1qhj Protein, lipid and water organization in bacteriorhodopsin crystals: a molecular view of the purple membrane at 1.9 A resolution.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RET	A	W86 T90 M118 W138 S141 T142 W182 Y185 P186 W189 D212 K216	W82 T86 M114 W134 S137 T138 W178 Y181 P182 W185 D208 K212
BS02	PH1	A	L48 I52 M56 Y64 W80 L87 F88 L92	L44 I48 M52 Y60 W76 L83 F84 L88
BS03	PH1	A	Y131 S132 F135 W138 A139	Y127 S128 F131 W134 A135
BS04	PH1	A	K172 R175 N176 V180 S183	K168 R171 N172 V176 S179
BS05	PH1	A	T107 A110 I117 I140 A144 Y147 Y150	T103 A106 I113 I136 A140 Y143 Y146
BS06	PH1	A	L149 Y150 F154 S183	L145 Y146 F150 S179
BS07	PH1	A	L19 Y26 V213 S214 V217 G218 L221 R225	L15 Y22 V209 S210 V213 G214 L217 R221

Gene Ontology

Molecular Function

• GO:0005216 monoatomic ion channel activity
• GO:0009881 photoreceptor activity
• GO:0015454 light-driven active monoatomic ion transmembrane transporter activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007602 phototransduction
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:1qhj, PDBe:1qhj, PDBj:1qhj
• PDBsum: 1qhj
• PubMed: 10467143
• UniProt: P02945|BACR_HALSA Bacteriorhodopsin (Gene Name=bop)