Structure of PDB 1qgw Chain A

Receptor sequence
>1qgwA (length=76) Species: 79257 (Rhodomonas sp. CS24) [Search protein sequence]
AMDKSAKAPQITIFDHRGCSRAPKESTGGKAGGQDDEMMVKVASTKVTVS
ESDAAKKLQEFITFEKGIDGPFTSKN
3D structure
PDB1qgw Evolution of a light-harvesting protein by addition of new subunits and rearrangement of conserved elements: crystal structure of a cryptophyte phycoerythrin at 1.63-A resolution.
ChainA
Resolution1.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DBV A F14 C19 R21 P23 E25 S26 E37 M38 M39 K41 F14 C19 R21 P23 E25 S26 E37 M38 M39 K41
BS02 DBV A I62 N76 I62 N76
BS03 PEB A F64 E65 K66 D69 G70 P71 F72 T73 S74 F64 E65 K66 D69 G70 P71 F72 T73 S74
BS04 PEB A M2 K4 A6 M2 K4 A6
BS05 PEB A I13 R17 Q34 M38 I13 R17 Q34 M38
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:1qgw, PDBe:1qgw, PDBj:1qgw
PDBsum1qgw
PubMed10430868
UniProtQ00433|PHE3_RHDS2 Phycoerythrin alpha-3 chain, chloroplastic (Gene Name=cpeA3)

[Back to BioLiP]