Structure of PDB 1qgh Chain A |
>1qghA (length=150) Species: 1642 (Listeria innocua) [Search protein sequence] |
VDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQ MDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTL ELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE |
|
PDB | 1qgh The dodecameric ferritin from Listeria innocua contains a novel intersubunit iron-binding site. |
Chain | A |
Resolution | 2.35 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
D58 E62 |
D52 E56 |
|
BS02 |
FE |
A |
H31 D47 |
H25 D41 |
|
|
|
|